- TfR (Transferrin R) Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85741
- Human
- CD71, IMD46, T9, TFR, TFR1, TR, TRFR, p90
- TfR (Transferrin R)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: KTECERLAGT ESPVREEPGE DFPAARRLYW DDLKRKLSEK LDSTDFTGTI KLLNENSYVP REAGSQKDEN LALYVENQFR EFKLSKV
- transferrin receptor
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cell Biology, Cellular Markers, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV
Specifications/Features
Available conjugates: Unconjugated